Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFarnesyl diphosphate synthase
LigandBDBM12578
Substrate/Competitorn/a
Meas. Tech.ChEMBL_466620
IC50 4.1±n/a nM
Citation Dunford, JEKwaasi, AARogers, MJBarnett, BLEbetino, FHRussell, RGOppermann, UKavanagh, KL Structure-activity relationships among the nitrogen containing bisphosphonates in clinical use and other analogues: time-dependent inhibition of human farnesyl pyrophosphate synthase. J Med Chem51:2187-95 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Farnesyl diphosphate synthase
Name:Farnesyl diphosphate synthase
Synonyms:Dimethylallyltranstransferase | FPP synthase | FPP synthetase | FPS | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | P14324
Type:Enzyme
Mol. Mass.:48272.89
Organism:Homo sapiens (Human)
Description:P14324
Residue:419
Sequence:
MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM12578
NameBDBM12578
Synonyms:2-(imidazol-1-yl)-1-hydroxyethylidene-1,1-bisphosphonic acid | Bisphosphonate 3 | CGP-42446 | CHEMBL924 | JMC515594 Compound 55 | Reclast | ZOL | Zoledronate | Zometa | [1-hydroxy-2-(1H-imidazol-1-yl)-1-phosphonoethyl]phosphonic acid | zoledronic acid
TypeSmall organic molecule
Emp. Form.C5H10N2O7P2
Mol. Mass.272.0896
SMILESOC(Cn1ccnc1)(P(O)(O)=O)P(O)(O)=O
Structure
n/a