Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50374606
Substrate/Competitorn/a
Meas. Tech.ChEMBL_469590
Ki 5.22±n/a nM
Citation Mésangeau, CNarayanan, SGreen, AMShaikh, JKaushal, NViard, EXu, YTFishback, JAPoupaert, JHMatsumoto, RRMcCurdy, CR Conversion of a highly selective sigma-1 receptor-ligand to sigma-2 receptor preferring ligands with anticocaine activity. J Med Chem51:1482-6 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma opioid receptor
Synonyms:Opioid receptor | Sigma | Sigma opioid receptor | Sigma-1
Type:Enzyme Catalytic Domain
Mol. Mass.:25266.54
Organism:RAT
Description:Q9R0C9
Residue:223
Sequence:
MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50374606
NameBDBM50374606
Synonyms:CHEMBL405925 | US9604926, Compound CM-124 | US9724435, Compound CM-124
TypeSmall organic molecule
Emp. Form.C20H29N3O2
Mol. Mass.343.4632
SMILESO=c1oc2ccccc2n1CCCN1CCN(CC1)C1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a