Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldo-keto reductase family 1 member C21
LigandBDBM7460
Substrate/Competitorn/a
Meas. Tech.ChEMBL_470435
Ki 11000±n/a nM
Citation Dhagat, UEndo, SHara, AEl-Kabbani, O Inhibition of 3(17)alpha-hydroxysteroid dehydrogenase (AKR1C21) by aldose reductase inhibitors. Bioorg Med Chem16:3245-54 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldo-keto reductase family 1 member C21
Name:Aldo-keto reductase family 1 member C21
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36879.72
Organism:Mus musculus
Description:ChEMBL_470435
Residue:323
Sequence:
MNSKCHCVILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDH
VGEAIRSKIADGTVRREDIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPM
ALKPGEENFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIGVSNFNYRQLEMILNKP
GLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPV
LGSMAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLN
RNMRYIPAAIFKGHPNWPFLDEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7460
n/a
NameBDBM7460
Synonyms:2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone;hydrate | CHEMBL50 | Quercetin | Quercetin (10) | Quercetin (21) | Quercetin (Qur) | US9180183, Quercetin
TypeSmall organic molecule
Emp. Form.C15H10O7
Mol. Mass.302.2357
SMILESOc1cc(O)c2c(c1)oc(-c1ccc(O)c(O)c1)c(O)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: