Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate racemase
LigandBDBM26431
Substrate/Competitorn/a
Meas. Tech.ChEMBL_475324
Ki 5800±n/a nM
Citation Lundqvist, TFisher, SLKern, GFolmer, RHXue, YNewton, DTKeating, TAAlm, RAde Jonge, BL Exploitation of structural and regulatory diversity in glutamate racemases. Nature447:817-822 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate racemase
Name:Glutamate racemase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:28413.39
Organism:Helicobacter pylori
Description:ChEMBL_475324
Residue:255
Sequence:
MKIGVFDSGVGGFSVLKSLLKAQLFDEIIYYGDSARVPYGTKDPTTIKQFGLEALDFFKP
HQIKLLIVACNTASALALEEMQKHSKIPVVGVIEPSILAIKRQVKDKNAPILVLGTKATI
QSNAYDNALKQQGYLNVSHLATSLFVPLIEESILEGELLETCMRYYFTPLEILPEVVILG
CTHFPLIAQKIEGYFMEHFALSTPPLLIHSGDAIVEYLQQNYALKKNACAFPKVEFHASG
DVVWLEKQAKEWLKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26431
NameBDBM26431
Synonyms:(2R)-2-aminopentanedioic acid | CHEMBL76232 | D-Glu | D-Glutamate | D-[14C]Glu
Typeradiolabeled amino acid
Emp. Form.C5H9NO4
Mol. Mass.147.1293
SMILESN[C@H](CCC(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a