Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate racemase
LigandBDBM50215444
Substrate/Competitorn/a
Meas. Tech.ChEMBL_475326
Kd 2900±n/a nM
Citation Lundqvist, TFisher, SLKern, GFolmer, RHXue, YNewton, DTKeating, TAAlm, RAde Jonge, BL Exploitation of structural and regulatory diversity in glutamate racemases. Nature447:817-822 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate racemase
Name:Glutamate racemase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:28413.39
Organism:Helicobacter pylori
Description:ChEMBL_475324
Residue:255
Sequence:
MKIGVFDSGVGGFSVLKSLLKAQLFDEIIYYGDSARVPYGTKDPTTIKQFGLEALDFFKP
HQIKLLIVACNTASALALEEMQKHSKIPVVGVIEPSILAIKRQVKDKNAPILVLGTKATI
QSNAYDNALKQQGYLNVSHLATSLFVPLIEESILEGELLETCMRYYFTPLEILPEVVILG
CTHFPLIAQKIEGYFMEHFALSTPPLLIHSGDAIVEYLQQNYALKKNACAFPKVEFHASG
DVVWLEKQAKEWLKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50215444
NameBDBM50215444
Synonyms:5-METHYL-7-(2-METHYLPROPYL)-2-(NAPHTHALEN-1-YLMETHYL)-3-PYRIDIN-4-YL-2H-PYRAZOLO[3,4-D]PYRIMIDINE-4,6(5H,7H)-DIONE | 7-isobutyl-5-methyl-2-(1-naphthylmethyl)-3-pyridin-4-yl-2H-pyrazolo[3,4-d]pyrimidine-4,6-(5H,7H)-dione | 7-isobutyl-5-methyl-2-(naphthalen-1-ylmethyl)-3-(pyridin-4-yl)-2H-pyrazolo[3,4-d]pyrimidine-4,6(5H,7H)-dione | CHEMBL401874
TypeSmall organic molecule
Emp. Form.C26H25N5O2
Mol. Mass.439.509
SMILESCC(C)Cn1c2nn(Cc3cccc4ccccc34)c(-c3ccncc3)c2c(=O)n(C)c1=O
Structure
n/a