Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-amino-N-butyrate transaminase
LigandBDBM50376751
Substrate/Competitorn/a
Meas. Tech.ChEMBL_477747
IC50>5000000±n/a nM
Citation Clift, MDSilverman, RB Synthesis and evaluation of novel aromatic substrates and competitive inhibitors of GABA aminotransferase. Bioorg Med Chem Lett18:3122-5 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gamma-amino-N-butyrate transaminase
Name:Gamma-amino-N-butyrate transaminase
Synonyms:(S)-3-amino-2-methylpropionate transaminase | 4-aminobutyrate aminotransferase, mitochondrial | GABA aminotransferase | GABA transaminase | GABA-AT | GABA-T | L-AIBAT
Type:PROTEIN
Mol. Mass.:56449.39
Organism:Homo sapiens (Human)
Description:ChEMBL_1459248
Residue:500
Sequence:
MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ
NASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYR
SKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50376751
NameBDBM50376751
Synonyms:ANTHRANILIC ACID
TypeSmall organic molecule
Emp. Form.C7H7NO2
Mol. Mass.137.136
SMILESNc1ccccc1C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a