Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombopoietin receptor
LigandBDBM50219625
Substrate/Competitorn/a
Meas. Tech.ChEMBL_479602
EC50 32±n/a nM
Citation Reiter, LAJones, CSBrissette, WHMcCurdy, SPAbramov, YABordner, JDiCapua, FMMunchhof, MJRescek, DMSamardjiev, IJWithka, JM Molecular features crucial to the activity of pyrimidine benzamide-based thrombopoietin receptor agonists. Bioorg Med Chem Lett18:3000-6 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thrombopoietin receptor
Name:Thrombopoietin receptor
Synonyms:C-mpl | CD_antigen=CD110 | Myeloproliferative leukemia protein | TPO-R
Type:PROTEIN
Mol. Mass.:71243.48
Organism:Homo sapiens
Description:ChEMBL_535587
Residue:635
Sequence:
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR
TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50219625
NameBDBM50219625
Synonyms:CHEMBL247606 | N-(4-(2-fluoro-3-(trifluoromethoxy)phenyl)thiazol-2-yl)-4-(pyrimidin-4-ylamino)benzamide
TypeSmall organic molecule
Emp. Form.C21H13F4N5O2S
Mol. Mass.475.419
SMILESFc1c(OC(F)(F)F)cccc1-c1csc(NC(=O)c2ccc(Nc3ccncn3)cc2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a