Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier family 22 member 20
LigandBDBM26193
Substrate/Competitorn/a
Meas. Tech.ChEMBL_508178
Ki 44000±n/a nM
Citation Kaler, GTruong, DMKhandelwal, ANagle, MEraly, SASwaan, PWNigam, SK Structural variation governs substrate specificity for organic anion transporter (OAT) homologs. Potential remote sensing by OAT family members. J Biol Chem282:23841-53 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Solute carrier family 22 member 20
Name:Solute carrier family 22 member 20
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:60953.19
Organism:Mus musculus
Description:ChEMBL_508178
Residue:556
Sequence:
MAFTDLLDALGGVGRFQLVYTALLLLPCGLLACHTFLQNFTAAAPPHHCQHPANYTEPTT
NVSGVWLRAAIPLNQHGDPEPCRRYVEPQWALLKPNASSHGVATEGCKDGWVYDRSIFPS
TIVMEWDLVCEARTLRDLAQSIYMSGVLVGAALFGGLADRLGRKAPLVWSYLQLAVSGAA
TAYVGSFSAYCVFRFLMGMTFSGIILNSLSLVVEWMPTRGRTVAGILLGFSFTLGQLILA
GVAYLIRPWRWLQFAVSAPFLVFFLYSWWLPESSRWLLLHGKAQQAVQNLQKVAMMNGRK
AEGERLTTEVVSSYIQDEFASVRTSNSILDLFRTPAIRRVTCCLMGVWFSNSVAYYGLAM
DLQKFGLSIYLVQALFGIIDIPAMLVATTTMIYVGRRATVSSFLILAGLMVIANMFMPED
LQTLRTVQAALGKGCLASSFICVYLFTGELYPTEIRQMGMGFASVNARLGGLVAPLITTL
GEISPVLPPVSFGATSVLAGMAVACFLTETRNVPLVETIAAMERRVKQGRSKRDTEQKSE
EISLQQLGASPLKETI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26193
NameBDBM26193
Synonyms:2-Hydroxybenzoate, I | 2-hydroxybenzoic acid | CHEMBL424 | phenol derivative, 7 | salicylic acid
TypeSmall organic molecule
Emp. Form.C7H6O3
Mol. Mass.138.1207
SMILESOC(=O)c1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a