Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetExcitatory amino acid transporter 1
LigandBDBM50252662
Substrate/Competitorn/a
Meas. Tech.ChEMBL_487936
Ki>3000000±n/a nM
Citation Sagot, EJensen, AAPickering, DSPu, XUmberti, MStensbøl, TBNielsen, BAssaf, ZAboab, BBolte, JGefflaut, TBunch, L Chemo-enzymatic synthesis of (2S,4R)-2-amino-4-(3-(2,2-diphenylethylamino)-3-oxopropyl)pentanedioic acid: a novel selective inhibitor of human excitatory amino acid transporter subtype 2. J Med Chem51:4085-92 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Excitatory amino acid transporter 1
Name:Excitatory amino acid transporter 1
Synonyms:Excitatory Amino Acid EAAT1
Type:Enzyme Catalytic Domain
Mol. Mass.:59577.19
Organism:Homo sapiens (Human)
Description:Excitatory Amino Acid EAAT1 0 HUMAN::P43003
Residue:542
Sequence:
MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIV
GTILGFTLRPYRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPP
NLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNG
VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPVGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFE
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT
TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSET
KM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50252662
NameBDBM50252662
Synonyms:(2S,4R)-4-(3-Propylamino-3-oxopropyl)glutamic acid | CHEMBL494878
TypeSmall organic molecule
Emp. Form.C11H20N2O5
Mol. Mass.260.2869
SMILESCCCNC(=O)CC[C@H](C[C@H](N)C(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a