Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate kainate
LigandBDBM50252050
Substrate/Competitorn/a
Meas. Tech.ChEMBL_487956
Ki 7.45±n/a nM
Citation Sagot, EPickering, DSPu, XUmberti, MStensbøl, TBNielsen, BChapelet, MBolte, JGefflaut, TBunch, L Chemo-enzymatic synthesis of a series of 2,4-syn-functionalized (S)-glutamate analogues: new insight into the structure-activity relation of ionotropic glutamate receptor subtypes 5, 6, and 7. J Med Chem51:4093-103 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate kainate
Name:Glutamate receptor ionotropic, kainate
Synonyms:Glutamate receptor ionotropic kainate 1 | Glutamate receptor ionotropic, kainate | Glutamate receptor, ionotropic kainate 1 | Glutamate-Kainate
Type:Enzyme Catalytic Domain
Mol. Mass.:107860.82
Organism:RAT
Description:Glutamate-Kainate Glutamate kainate RAT::P22756
Residue:949
Sequence:
MERSTVLIQPGLWTRDTSWTLLYFLCYILPQTSPQVLRIGGIFETVENEPVNVEELAFKF
AVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDSRDLFYINLYPDYAAISRAVLDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPPANKDAKPLLKEMKKSKEFYVIFDCSHETAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRKLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPCALGPRF
MNLIKEARWDGLTGRITFNKTDGLRKDFDLDIISLKEEGTEKASGEVSKHLYKVWKKIGI
WNSNSGLNMTDGNRDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEAYCL
DLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREK
VIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFT
PYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTL
IIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKM
WAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDSKEASALGVENIGGIFI
VLAAGLVLSVFVAIGEFLYKSRKNNDVEQKGKSSRLRFYFRNKVRFHGSKKESLGVEKCL
SFNAIMEELGISLKNQKKLKKKSRTKGKSSFTSILTCHQRRTQRKETVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50252050
NameBDBM50252050
Synonyms:(2S,4R)-2-amino-4-(3-amino-3-oxopropyl)pentanedioic acid | (2S,4R)-4-(3-Amino-3-oxopropyl)glutamic acid | CHEMBL479804
TypeSmall organic molecule
Emp. Form.C8H14N2O5
Mol. Mass.218.2072
SMILESN[C@@H](C[C@@H](CCC(N)=O)C(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a