Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50377955
Substrate/Competitorn/a
Meas. Tech.ChEMBL_487377
Ki 19±n/a nM
Citation Su, DSLim, JLTinney, EWan, BLMurphy, KLReiss, DRHarrell, CMO'Malley, SSRansom, RWChang, RSPettibone, DJYu, JTang, CPrueksaritanont, TFreidinger, RMBock, MGAnthony, NJ 2-Aminobenzophenones as a novel class of bradykinin B1 receptor antagonists. J Med Chem51:3946-52 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50377955
NameBDBM50377955
Synonyms:CHEMBL1203967
TypeSmall organic molecule
Emp. Form.C23H24N4O4S
Mol. Mass.452.526
SMILESCNCCNC(=O)Nc1ccc(cc1)S(=O)(=O)Nc1ccccc1C(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a