Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombopoietin receptor
LigandBDBM50263334
Substrate/Competitorn/a
Meas. Tech.ChEMBL_535587
EC50 35±n/a nM
Citation Alper, PBMarsilje, THMutnick, DLu, WChatterjee, ARoberts, MJHe, YKaranewsky, DSChow, DLao, JGerken, ATuntland, TLiu, BChang, JGordon, PSeidel, HMTian, SS Discovery and biological evaluation of benzo[a]carbazole-based small molecule agonists of the thrombopoietin (Tpo) receptor. Bioorg Med Chem Lett18:5255-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thrombopoietin receptor
Name:Thrombopoietin receptor
Synonyms:C-mpl | CD_antigen=CD110 | Myeloproliferative leukemia protein | TPO-R
Type:PROTEIN
Mol. Mass.:71243.48
Organism:Homo sapiens
Description:ChEMBL_535587
Residue:635
Sequence:
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR
TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50263334
NameBDBM50263334
Synonyms:9-(4-fluoro-3-methylphenyl)-2-hydroxy-6,11-dihydro-5H-benzo[a]carbazole-3-carboxylic acid | CHEMBL477381
TypeSmall organic molecule
Emp. Form.C24H18FNO3
Mol. Mass.387.403
SMILESCc1cc(ccc1F)-c1ccc2c3CCc4cc(C(O)=O)c(O)cc4-c3[nH]c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a