Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGalectin-8
LigandBDBM50370453
Substrate/Competitorn/a
Meas. Tech.ChEMBL_560907
Kd 62000±n/a nM
Citation Delaine, TCumpstey, IIngrassia, LLe Mercier, MOkechukwu, PLeffler, HKiss, RNilsson, UJ Galectin-inhibitory thiodigalactoside ester derivatives have antimigratory effects in cultured lung and prostate cancer cells. J Med Chem51:8109-14 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Galectin-8
Name:Galectin-8
Synonyms:Gal-8 | PCTA-1 | Po66 carbohydrate-binding protein | Po66-CBP | Prostate carcinoma tumor antigen 1
Type:PROTEIN
Mol. Mass.:35814.23
Organism:Homo sapiens (Human)
Description:ChEMBL_1454625
Residue:317
Sequence:
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRA
DVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNG
KHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGT
PQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFV
RNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSI
DTLEINGDIHLLEVRSW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50370453
NameBDBM50370453
Synonyms:LACTOSE | Lactose, anhydrous
TypeSmall organic molecule
Emp. Form.C12H22O11
Mol. Mass.342.2965
SMILESOC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a