Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetβ-Ketoacyl-acyl carrier protein (ACP) synthase III (FabH)
LigandBDBM50245923
Substrate/Competitorn/a
Meas. Tech.ChEMBL_559691
IC50 1.49±n/a nM
Citation Alhamadsheh, MMWaters, NCSachdeva, SLee, PReynolds, KA Synthesis and biological evaluation of novel sulfonyl-naphthalene-1,4-diols as FabH inhibitors. Bioorg Med Chem Lett18:6402-5 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
β-Ketoacyl-acyl carrier protein (ACP) synthase III (FabH)
Name:β-Ketoacyl-acyl carrier protein (ACP) synthase III (FabH)
Synonyms:3-oxoacyl-[acyl-carrier-protein] synthase III
Type:Enzyme
Mol. Mass.:34865.07
Organism:Mycobacterium tuberculosis
Description:P9WNG3
Residue:335
Sequence:
MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADDES
AASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSA
GCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYDRGNCFIFADGAAAVVVGETP
FQGIGPTVAGSDGEQADAIRQDIDWITFAQNPSGPRPFVRLEGPAVFRWAAFKMGDVGRR
AMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANDIEHTGNTSAASIPLAMA
ELLTTGAAKPGDLALLIGYGAGLSYAAQVVRMPKG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50245923
n/a
NameBDBM50245923
Synonyms:2-(naphthalen-2-ylsulfonyl)naphthalene-1,4-diol | CHEMBL462374
TypeSmall organic molecule
Emp. Form.C20H14O4S
Mol. Mass.350.388
SMILESOc1cc(c(O)c2ccccc12)S(=O)(=O)c1ccc2ccccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: