Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 4 (mGluR4)
LigandBDBM50254337
Substrate/Competitorn/a
Meas. Tech.ChEMBL_559521
Ki>1000000±n/a nM
Citation Filosa, RCarmela Fulco, MMarinozzi, MGiacchè, NMacchiarulo, APeduto, AMassa, Ade Caprariis, PThomsen, CChristoffersen, CTPellicciari, R Design, synthesis and biological evaluation of novel bicyclo[1.1.1]pentane-based omega-acidic amino acids as glutamate receptors ligands. Bioorg Med Chem17:242-50 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 4 (mGluR4)
Name:Metabotropic glutamate receptor 4
Synonyms:GRM4 | Glutamate receptor, metabotropic 4 | Metabotropic glutamate receptor 4 | mGluR4 | metabotropic glutamate 4
Type:Protein
Mol. Mass.:101899.95
Organism:Homo sapiens (Human)
Description:Q14833
Residue:912
Sequence:
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIA
ATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALAT
KQTYVTYTNHAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50254337
NameBDBM50254337
Synonyms:(2S)-3-(3'-Carboxybicyclo[1.1.1]pentyl)alanine | CHEMBL444718
TypeSmall organic molecule
Emp. Form.C9H13NO4
Mol. Mass.199.2038
SMILESN[C@@H](CC12CC(C1)(C2)C(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a