Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSulfonylurea receptor 2, Kir6.2
LigandBDBM50062397
Substrate/Competitorn/a
Meas. Tech.ChEMBL_495672
EC50 230±n/a nM
Citation Zhang, XQiu, YLi, XBhattacharjee, SWoods, MKraft, PLundeen, SGSui, Z Discovery and structure-activity relationships of a novel series of benzopyran-based K(ATP) openers for urge urinary incontinence. Bioorg Med Chem17:855-66 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sulfonylurea receptor 2, Kir6.2
Name:Sulfonylurea receptor 2, Kir6.2
Synonyms:ATP-binding cassette transporter sub-family C member 9 | Sulfonylurea receptor 2
Type:PROTEIN
Mol. Mass.:174236.59
Organism:Homo sapiens
Description:ChEMBL_495672
Residue:1549
Sequence:
MSLSFCGNNISSYNINDGVLQNSCFVDALNLVPHVFLLFITFPILFIGWGSQSSKVQIHH
NTWLHFPGHNLRWILTFALLFVHVCEIAEGIVSDSRRESRHLHLFMPAVMGFVATTTSIV
YYHNIETSNFPKLLLALFLYWVMAFITKTIKLVKYCQSGLDISNLRFCITGMMVILNGLL
MAVEINVIRVRRYVFFMNPQKVKPPEDLQDLGVRFLQPFVNLLSKATYWWMNTLIISAHK
KPIDLKAIGKLPIAMRAVTNYVCLKDAYEEQKKKVADHPNRTPSIWLAMYRAFGRPILLS
STFRYLADLLGFAGPLCISGIVQRVNETQNGTNNTTGISETLSSKEFLENAYVLAVLLFL
ALILQRTFLQASYYVTIETGINLRGALLAMIYNKILRLSTSNLSMGEMTLGQINNLVAIE
TNQLMWFLFLCPNLWAMPVQIIMGVILLYNLLGSSALVGAAVIVLLAPIQYFIATKLAEA
QKSTLDYSTERLKKTNEILKGIKLLKLYAWEHIFCKSVEETRMKELSSLKTFALYTSLSI
FMNAAIPIAAVLATFVTHAYASGNNLKPAEAFASLSLFHILVTPLFLLSTVVRFAVKAII
SVQKLNEFLLSDEIGDDSWRTGESSLPFESCKKHTGVQPKTINRKQPGRYHLDSYEQSTR
RLRPAETEDIAIKVTNGYFSWGSGLATLSNIDIRIPTGQLTMIVGQVGCGKSSLLLAILG
EMQTLEGKVHWSNVNESEPSFEATRSRNRYSVAYAAQKPWLLNATVEENITFGSPFNKQR
YKAVTDACSLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFS
ALDIHLSDHLMQEGILKFLQDDKRTLVLVTHKLQYLTHADWIIAMKDGSVLREGTLKDIQ
TKDVELYEHWKTLMNRQDQELEKDMEADQTTLERKTLRRAMYSREAKAQMEDEDEEEEEE
EDEDDNMSTVMRLRTKMPWKTCWRYLTSGGFFLLILMIFSKLLKHSVIVAIDYWLATWTS
EYSINNTGKADQTYYVAGFSILCGAGIFLCLVTSLTVEWMGLTAAKNLHHNLLNKIILGP
IRFFDTTPLGLILNRFSADTNIIDQHIPPTLESLTRSTLLCLSAIGMISYATPVFLVALL
PLGVAFYFIQKYFRVASKDLQELDDSTQLPLLCHFSETAEGLTTIRAFRHETRFKQRMLE
LTDTNNIAYLFLSAANRWLEVRTDYLGACIVLTASIASISGSSNSGLVGLGLLYALTITN
YLNWVVRNLADLEVQMGAVKKVNSFLTMESENYEGTMDPSQVPEHWPQEGEIKIHDLCVR
YENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDISKL
PLHTLRSRLSIILQDPILFSGSIRFNLDPECKCTDDRLWEALEIAQLKNMVKSLPGGLDA
VVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQKVVMTAFADRTV
VTIAHRVSSIMDAGLVLVFSEGILVECDTVPNLLAHKNGLFSTLVMTNK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50062397
NameBDBM50062397
Synonyms:3N-cyanoimino(tert-pentylamino)methyl-3-pyridinamine | 3N-cyanoimino(tert-pentylamino)methyl-3-pyridinamineP1075) | CHEMBL11458 | N''-cyano-N-(1,1-dimethylpropyl)-N'-pyridin-3-ylguanidine | N-cyano-N''-(1,1-dimethylpropyl)-N'-pyridin-3-ylguanidine | P-1075
TypeSmall organic molecule
Emp. Form.C12H17N5
Mol. Mass.231.2969
SMILESCCC(C)(C)NC(NC#N)=Nc1cccnc1 |w:10.10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a