Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGhrelin receptor
LigandBDBM50267949
Substrate/Competitorn/a
Meas. Tech.ChEMBL_563165
IC50>2000000±n/a nM
Citation Rosita, DDewit, MALuyt, LG Fluorine and rhenium substituted ghrelin analogues as potential imaging probes for the growth hormone secretagogue receptor. J Med Chem52:2196-203 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ghrelin receptor
Name:Ghrelin receptor
Synonyms:GH-releasing peptide receptor | GHRP | GHS-R | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor 1a (GHS-R1a)
Type:Receptor
Mol. Mass.:41334.57
Organism:Homo sapiens (Human)
Description:Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a.
Residue:366
Sequence:
MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50267949
NameBDBM50267949
Synonyms:(4S)-4-{[(2S)-1-[(2S)-2-[(2S)-2-[(2S)-2-[(2S)-3-(acetyloxy)-2-[(2S)-2-(2-aminoacetamido)-3-hydroxypropanamido]propanamido]-3-phenylpropanamido]-4-methylpentanamido]-3-hydroxypropanoyl]pyrrolidin-2-yl]formamido}-4-{[(1S)-1-{[(1S)-1-{[(1S)-1-{[(1S)-1-{[(1S)-1-{[(1S)-1-{[(1S)-1-{[(1S)-5-amino-1-{[(1S)-1-{[(1S)-1-{[(1S)-5-amino-1-{[(2S)-6-amino-1-[(2S)-2-{[(2S)-2-{[(1S)-1-{[(1S)-5-amino-1-{[(1S)-1-{[(2S)-1-[(2S)-2-{[(1S)-4-carbamimidamido-1-carboxybutyl]carbamoyl}pyrrolidin-1-yl]-4-carbamoyl-1-oxobu | CHEMBL504856
TypeSmall organic molecule
Emp. Form.C143H237N47O42
Mol. Mass.3286.7016
SMILESCC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](COC(C)=O)NC(=O)[C@H](CO)NC(=O)CN)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCN=C(N)N)C(O)=O |r,wU:8.16,39.39,48.50,80.82,91.93,116.118,136.138,151.153,160.162,183.188,107.109,61.62,197.201,wD:4.4,52.53,71.73,127.129,145.147,172.176,179.184,188.192,205.209,217.223,221.226,19.25,28.31,98.100,(7.5,-7.44,;6.19,-6.65,;6.22,-5.11,;4.85,-7.38,;3.53,-6.58,;2.17,-7.32,;2.13,-8.86,;3.45,-9.66,;.79,-9.61,;-.52,-8.8,;-.49,-7.26,;.84,-6.54,;.87,-5,;-.44,-4.21,;-1.79,-4.95,;-1.81,-6.48,;.76,-11.15,;-.58,-11.89,;-1.9,-11.1,;-.61,-13.43,;.71,-14.22,;2.06,-13.47,;3.38,-14.26,;4.72,-13.51,;3.36,-15.8,;-1.95,-14.18,;-3.48,-14.2,;-4.27,-12.86,;-4.25,-15.54,;-3.47,-16.87,;-1.91,-16.85,;-5.79,-15.56,;-6.55,-16.9,;-5.77,-18.23,;-8.09,-16.92,;-8.85,-18.26,;3.56,-5.04,;2.24,-4.24,;4.91,-4.31,;4.94,-2.77,;3.63,-1.97,;3.67,-.46,;6.29,-2.01,;7.6,-2.82,;6.4,-.49,;5.22,.69,;5.95,2.19,;7.6,1.94,;7.62,.4,;8.97,-.3,;9.05,-1.84,;10.28,.53,;11.64,-.17,;11.71,-1.7,;13.1,-2.42,;13.18,-3.93,;11.88,-4.75,;14.56,-4.65,;12.95,.66,;12.88,2.22,;14.32,-.05,;15.6,.8,;15.53,2.35,;16.81,3.17,;16.89,4.71,;18.37,5.11,;19.2,3.83,;18.25,2.62,;16.97,.09,;17.03,-1.42,;18.26,.93,;19.62,.24,;19.69,-1.29,;18.41,-2.11,;18.48,-3.67,;19.86,-4.37,;17.2,-4.49,;20.92,1.07,;20.86,2.63,;22.28,.38,;23.6,1.22,;23.52,2.77,;22.14,3.47,;22.06,5,;20.69,5.7,;20.61,7.23,;21.89,8.06,;19.23,7.96,;24.94,.51,;25.02,-1,;26.25,1.36,;27.61,.65,;28.92,1.49,;28.85,3.04,;30.27,.8,;27.69,-.86,;26.39,-1.69,;29.06,-1.58,;29.14,-3.11,;27.85,-3.95,;26.49,-3.24,;25.18,-4.09,;25.26,-5.63,;23.82,-3.39,;30.51,-3.83,;31.82,-2.99,;30.63,-5.37,;31.98,-6.09,;33.28,-5.26,;34.64,-5.96,;35.96,-5.11,;35.88,-3.56,;37.3,-5.82,;32.06,-7.62,;30.78,-8.44,;33.44,-8.34,;33.51,-9.85,;34.89,-10.57,;36.19,-9.72,;37.55,-10.43,;38.86,-9.59,;40.21,-10.28,;40.28,-11.81,;41.52,-9.45,;32.22,-10.69,;30.87,-9.98,;32.29,-12.24,;31.01,-13.06,;29.66,-12.36,;29.59,-10.83,;28.21,-10.13,;28.14,-8.6,;26.76,-7.88,;31.09,-14.6,;32.47,-15.32,;29.81,-15.44,;29.88,-16.99,;31.26,-17.7,;32.56,-16.86,;33.92,-17.57,;34.01,-19.08,;35.23,-16.72,;28.6,-17.82,;27.24,-17.11,;28.66,-19.37,;27.38,-20.19,;26.03,-19.5,;24.74,-20.32,;27.46,-21.74,;28.83,-22.45,;26.18,-22.57,;26.25,-24.12,;27.63,-24.84,;28.94,-23.99,;30.29,-24.68,;31.6,-23.85,;32.96,-24.55,;24.96,-24.94,;23.61,-24.25,;25.03,-26.5,;26.42,-27.2,;27.72,-26.37,;29.08,-27.07,;29.16,-28.6,;30.54,-29.3,;30.61,-30.83,;26.49,-28.73,;27.88,-29.43,;25.2,-29.55,;23.61,-29.09,;22.65,-30.46,;23.66,-31.8,;25.02,-31.05,;26.3,-31.93,;27.65,-31.18,;26.26,-33.47,;24.96,-34.52,;25.55,-36.09,;27.23,-36.01,;27.38,-34.46,;28.82,-33.9,;29.04,-32.38,;30.02,-34.86,;31.45,-34.3,;31.68,-32.79,;32.66,-35.27,;32.42,-36.78,;34.09,-34.71,;35.29,-35.67,;35.06,-37.19,;36.26,-38.15,;36.03,-39.68,;37.23,-40.63,;36.99,-42.16,;36.73,-35.11,;36.95,-33.58,;37.94,-36.05,;39.39,-35.51,;39.63,-34,;41.05,-33.44,;41.29,-31.91,;42.26,-34.39,;40.59,-36.48,;40.36,-37.99,;42.03,-35.92,;43.23,-36.88,;43,-38.4,;41.56,-38.96,;41.33,-40.49,;39.89,-41.05,;42.53,-41.45,;44.67,-36.32,;44.89,-34.81,;45.87,-37.29,;45.92,-38.96,;47.52,-39.44,;48.47,-38.06,;47.33,-37,;47.76,-35.51,;46.69,-34.42,;49.26,-35.15,;49.68,-33.67,;51.18,-33.31,;52.25,-34.4,;53.74,-34.04,;54.81,-35.13,;56.31,-34.77,;56.73,-33.28,;57.38,-35.87,;48.61,-32.56,;47.12,-32.91,;49.04,-31.09,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a