Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Aurora-C
LigandBDBM50307127
Substrate/Competitorn/a
Meas. Tech.ChEMBL_586734
IC50 17±n/a nM
Citation Bain, JPlater, LElliott, MShpiro, NHastie, CJMcLauchlan, HKlevernic, IArthur, JSAlessi, DRCohen, P The selectivity of protein kinase inhibitors: a further update. Biochem J408:297-315 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Aurora-C
Name:Serine/threonine-protein kinase Aurora-C
Synonyms:Aurora kinase C | Aurora kinase C (AURKC) | Aurora-C | Aurora/Ipl1-related kinase 3 | Aurora/Ipl1/Eg2 protein 2 | Serine/threonine-protein kinase 13
Type:Enzyme
Mol. Mass.:35602.43
Organism:Homo sapiens (Human)
Description:Amino acid residues 1-309 were expressed as His-tagged fusion protein using baculovirus expression system.
Residue:309
Sequence:
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLA
RLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLIL
EYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEV
KIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFE
SASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
LPPCAQMAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50307127
NameBDBM50307127
Synonyms:(3Z)-N,N-DIMETHYL-2-OXO-3-(4,5,6,7-TETRAHYDRO-1H-INDOL-2-YLMETHYLIDENE)-2,3-DIHYDRO-1H-INDOLE-5-SULFONAMIDE | (Z)-N,N-dimethyl-2-oxo-3-((4,5,6,7-tetrahydro-1H-indol-2-yl)methylene)indoline-5-sulfonamide | CHEMBL605003 | N,N-dimethyl-2-oxo-3-((4,5,6,7-tetrahydro-1H-indol-2-yl)methylene)indoline-5-sulfonamide | SU-6656
TypeSmall organic molecule
Emp. Form.C19H21N3O3S
Mol. Mass.371.453
SMILESCN(C)S(=O)(=O)c1ccc2NC(=O)\C(=C/c3cc4CCCCc4[nH]3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a