Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDeath-associated protein kinase 3
LigandBDBM5447
Substrate/Competitorn/a
Meas. Tech.ChEMBL_586564
Kd 57±n/a nM
Citation Karaman, MWHerrgard, STreiber, DKGallant, PAtteridge, CECampbell, BTChan, KWCiceri, PDavis, MIEdeen, PTFaraoni, RFloyd, MHunt, JPLockhart, DJMilanov, ZVMorrison, MJPallares, GPatel, HKPritchard, SWodicka, LMZarrinkar, PP A quantitative analysis of kinase inhibitor selectivity. Nat Biotechnol26:127-32 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Death-associated protein kinase 3
Name:Death-associated protein kinase 3
Synonyms:DAP kinase 3 | DAP-like kinase | DAPK3 | ZIP-kinase
Type:PROTEIN
Mol. Mass.:52537.07
Organism:Homo sapiens
Description:ChEMBL_586564
Residue:454
Sequence:
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5447
NameBDBM5447
Synonyms:CHEMBL939 | GEFITINIB | Iressa | N-(3-Chloro-4-fluorophenyl)-7-methoxy-6-[3-(4-morpholinyl)propoxy]-4-quinazolinamine | N-(3-chloro-4-fluorophenyl)-7-methoxy-6-[3-(morpholin-4-yl)propoxy]quinazolin-4-amine | US10106508, Gefitinib | US9416123, Gefitinib | ZD1839 | cid_123631
TypeSmall organic molecule
Emp. Form.C22H24ClFN4O3
Mol. Mass.446.902
SMILESCOc1cc2ncnc(Nc3ccc(F)c(Cl)c3)c2cc1OCCCN1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a