Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-tyrosine kinase 2-beta
LigandBDBM50301356
Substrate/Competitorn/a
Meas. Tech.ChEMBL_599549
EC50 10±n/a nM
Citation Allen, JGLee, MRHan, CYScherrer, JFlynn, SBoucher, CZhao, HO'Connor, ABRoveto, PBauer, DGraceffa, RRichards, WGBabij, P Identification of small molecule inhibitors of proline-rich tyrosine kinase 2 (Pyk2) with osteogenic activity in osteoblast cells. Bioorg Med Chem Lett19:4924-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-tyrosine kinase 2-beta
Name:Protein-tyrosine kinase 2-beta
Synonyms:CADTK | CAK-beta | CAKB | Calcium-dependent tyrosine kinase | Calcium-regulated non-receptor proline-rich tyrosine kinase | Cell adhesion kinase beta | FADK 2 | Fak2 | Focal adhesion kinase 2 | Focaladhesion kinase 2 | Proline-rich tyrosine kinase 2 | Ptk2b | Pyk2 | RAFTK | Related adhesion focal tyrosine kinase
Type:PROTEIN
Mol. Mass.:115790.07
Organism:Mus musculus
Description:ChEMBL_885497
Residue:1009
Sequence:
MSGVSEPLSRVKVGTLRRPEGPPEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIQEIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDTKPTCLA
EFKQIKSIRCLPLEETQAVLQLGIEGAPQSLSIKTSSLAEAENMADLIDGYCRLQGEHKG
SLIMHAKKDGEKRNSLPQIPTLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGV
AREEVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTQDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVPTLVLYTLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPELCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDIYQMEKDIAIEQERNARYRPPKILEPTTFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKIKMKQVLERQQKQMVEDSQWLRREERCLDPMVYMNDKSP
LTPEKEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYHNVMTLVEAVLELKNKLGQ
LPPEDYVVVVKNVGLNLRKLIGSVDDLLPSLPASSRTEIEGTQKLLNKDLAELINKMKLA
QQNAVTSLSEDCKRQMLTASHTLAVDAKNLLDAVDQAKVVANLAHPPAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50301356
NameBDBM50301356
Synonyms:CHEMBL585927 | N-(5-(6,7-dimethoxyquinolin-4-yloxy)pyridin-2-yl)-4-(methylamino)-2-oxo-1-phenyl-1,2-dihydropyridine-3-carboxamide
TypeSmall organic molecule
Emp. Form.C29H25N5O5
Mol. Mass.523.5393
SMILESCNc1ccn(-c2ccccc2)c(=O)c1C(=O)Nc1ccc(Oc2ccnc3cc(OC)c(OC)cc23)cn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a