Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase III
LigandBDBM26188
Substrate/Competitorn/a
Meas. Tech.ChEMBL_613330
Ki 13000±n/a nM
Citation Innocenti, ABeyza Oztürk Sarikaya, SGülçin, ISupuran, CT Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. Bioorg Med Chem18:2159-64 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase III
Name:Carbonic Anhydrase III
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 (CA III) | Carbonic anhydrase III (CA III)
Type:Enzyme
Mol. Mass.:29562.11
Organism:Homo sapiens (Human)
Description:Human cloned isozyme.
Residue:260
Sequence:
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26188
NameBDBM26188
Synonyms:α-CA inhibitor, 12 | 1,2-Dihydroxybenzene, XI | 1,2-dihydroxybenzene | CHEMBL280998 | benzene-1,2-diol | phenol derivative, 2
TypeSmall organic molecule
Emp. Form.C6H6O2
Mol. Mass.110.1106
SMILESOc1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a