Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50079654
Substrate/Competitorn/a
Meas. Tech.ChEMBL_613353
Ki 6.6±n/a nM
Citation Scheiff, ABYerande, SGEl-Tayeb, ALi, WInamdar, GSVasu, KKSudarsanam, VMüller, CE 2-Amino-5-benzoyl-4-phenylthiazoles: Development of potent and selective adenosine A1 receptor antagonists. Bioorg Med Chem18:2195-203 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079654
NameBDBM50079654
Synonyms:4-(6-oxo-3-(2-phenylpyrazolo[1,5-a]pyridin-3-yl)pyridazin-1(6H)-yl)butanoic acid | 4-[6-Oxo-3-(2-phenyl-pyrazolo[1,5-a]pyridin-3-yl)-6H-pyridazin-1-yl]-butyric acid | CHEMBL292917
TypeSmall organic molecule
Emp. Form.C21H18N4O3
Mol. Mass.374.3926
SMILESOC(=O)CCCn1nc(ccc1=O)-c1c(nn2ccccc12)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a