Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Receptors A2a (A2a)
LigandBDBM50308487
Substrate/Competitorn/a
Meas. Tech.ChEMBL_613345
Ki 662±n/a nM
Citation Scheiff, ABYerande, SGEl-Tayeb, ALi, WInamdar, GSVasu, KKSudarsanam, VMüller, CE 2-Amino-5-benzoyl-4-phenylthiazoles: Development of potent and selective adenosine A1 receptor antagonists. Bioorg Med Chem18:2195-203 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine Receptors A2a (A2a)
Name:Adenosine receptor A2a and A3
Synonyms:ADENOSINE A2a | Adenosine A2a receptor (A2a) | Adenosine receptors A2a | Rat striatal adenosine A2a receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45015.65
Organism:Rattus norvegicus (rat)
Description:Rat A2A receptors expressed in CHO cells.
Residue:410
Sequence:
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50308487
NameBDBM50308487
Synonyms:CHEMBL591710 | N-(5-Benzoyl-4-phenylthiazol-2-yl)furan-2-carboxamide
TypeSmall organic molecule
Emp. Form.C21H14N2O3S
Mol. Mass.374.412
SMILESO=C(Nc1nc(c(s1)C(=O)c1ccccc1)-c1ccccc1)c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a