Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50315545
Substrate/Competitorn/a
Meas. Tech.ChEMBL_627305
Ki 0.19±n/a nM
Citation Mishra, CBBarodia, SKPrakash, ASenthil Kumar, JBLuthra, PM Novel 8-(furan-2-yl)-3-substituted thiazolo [5,4-e][1,2,4] triazolo[1,5-c] pyrimidine-2(3H)-thione derivatives as potential adenosine A(2A) receptor antagonists. Bioorg Med Chem18:2491-500 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor A1/Alpha-2A adrenergic receptor
Synonyms:A1 adenosine receptor (hA1) | A1AR | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36520.92
Organism:Homo sapiens (human)
Description:Expressed in CHO cells
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50315545
n/a
NameBDBM50315545
Synonyms:8-(2-Thioxo-7(3-m-chlorophenyl)-2-(2-furyl)thiazolo[4,3-e]1,2,4-triazolo[1,5-c]pyrimidine | CHEMBL1090578
TypeSmall organic molecule
Emp. Form.C16H8ClN5OS2
Mol. Mass.385.851
SMILESClc1cccc(c1)-n1c2ncn3nc(nc3c2sc1=S)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: