Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B/Inner centromere protein
LigandBDBM50315769
Substrate/Competitorn/a
Meas. Tech.ChEMBL_630521
Ki 0.380000±n/a nM
Citation Adams, NDAdams, JLBurgess, JLChaudhari, AMCopeland, RADonatelli, CADrewry, DHFisher, KEHamajima, THardwicke, MAHuffman, WFKoretke-Brown, KKLai, ZVMcDonald, OBNakamura, HNewlander, KAOleykowski, CAParrish, CAPatrick, DRPlant, RSarpong, MASasaki, KSchmidt, SJSilva, DJSutton, DTang, JThompson, CSTummino, PJWang, JCXiang, HYang, JDhanak, D Discovery of GSK1070916, a potent and selective inhibitor of Aurora B/C kinase. J Med Chem53:3973-4001 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B/Inner centromere protein
Name:Aurora kinase A/B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50315769
NameBDBM50315769
Synonyms:3-(4-(4-(2-(3-((dimethylamino)methyl)phenyl)-1H-pyrrolo[2,3-b]pyridin-4-yl)-1-ethyl-1H-pyrazol-3-yl)phenyl)-1,1-dimethylurea | 4-[3-(4-N,N-Dimethylcarbamylaminophenyl)-1-ethyl-1H-pyrazol-4-yl]-2-[3-(dimethylaminomethyl)phenyl]-1H-pyrrolo[2,3-b]-pyridine | CHEMBL1090479 | GSK-1070916
TypeSmall organic molecule
Emp. Form.C30H33N7O
Mol. Mass.507.6293
SMILESCCn1cc(c(n1)-c1ccc(NC(=O)N(C)C)cc1)-c1ccnc2[nH]c(cc12)-c1cccc(CN(C)C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a