Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycine transporter 1
LigandBDBM50322445
Substrate/Competitorn/a
Meas. Tech.ChEMBL_643222
EC50 430±n/a nM
Citation Pinard, EAlanine, AAlberati, DBender, MBorroni, EBourdeaux, PBrom, VBurner, SFischer, HHainzl, DHalm, RHauser, NJolidon, SLengyel, JMarty, HPMeyer, TMoreau, JLMory, RNarquizian, RNettekoven, MNorcross, RDPuellmann, BSchmid, PSchmitt, SStalder, HWermuth, RWettstein, JGZimmerli, D Selective GlyT1 inhibitors: discovery of [4-(3-fluoro-5-trifluoromethylpyridin-2-yl)piperazin-1-yl][5-methanesulfonyl-2-((S)-2,2,2-trifluoro-1-methylethoxy)phenyl]methanone (RG1678), a promising novel medicine to treat schizophrenia. J Med Chem53:4603-14 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glycine transporter 1
Name:Glycine transporter 1
Synonyms:GlyT-1 | GlyT1 | Glycine Transporters (GlyT1c) | Sodium- and chloride-dependent glycine transporter 1 | Sodium- and chloride-dependent glycine transporter 1 (GlyT1) | Sodium- and chloride-dependent glycine transporter 1 (GlyT1c) | Sodium-and chloride-dependent glycine transporter 1 (GlyT-1c) | Solute carrier family 6 member 9
Type:Enzyme
Mol. Mass.:78270.54
Organism:Homo sapiens (Human)
Description:P48067
Residue:706
Sequence:
MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKV
WHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGL
GNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKG
VGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTN
GSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLV
VFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKV
WGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGF
MANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETL
VTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVIS
CIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITY
NHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLE
HRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50322445
NameBDBM50322445
Synonyms:CHEMBL1172010 | rac-[5-Methanesulfonyl-2-(2,2,2-trifluoro-1-methyl-ethoxy)-phenyl]-[4-(4-methoxy-phenyl)piperazin-1-yl]-methanone
TypeSmall organic molecule
Emp. Form.C22H25F3N2O5S
Mol. Mass.486.505
SMILESCOc1ccc(cc1)N1CCN(CC1)C(=O)c1cc(ccc1OC(C)C(F)(F)F)S(C)(=O)=O
Structure
n/a