Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor
LigandBDBM50323901
Substrate/Competitorn/a
Meas. Tech.ChEMBL_647615
EC50 1400±n/a nM
Citation Dong, XWang, LHuang, XLiu, TWei, EDu, LYang, BHu, Y Pharmacophore identification, synthesis, and biological evaluation of carboxylated chalcone derivatives as CysLT1 antagonists. Bioorg Med Chem18:5519-27 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cysteinyl leukotriene receptor
Name:Cysteinyl leukotriene receptor
Synonyms:CYSLTR1 | Cysteinyl leukotriene D4 receptor | Cysteinyl leukotriene receptor | HG55 | HMTMF81 | LTD4 receptor | Leukotriene Cysteinyl 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38565.16
Organism:HUMAN
Description:Leukotriene Cysteinyl 1 CYSLTR1 HUMAN::Q9Y271
Residue:337
Sequence:
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50323901
NameBDBM50323901
Synonyms:CHEMBL1213846 | E-2-(2-(3-(4-(4-(4-Chlorophenoxy)butoxy)phenyl)acryloyl)phenoxy)acetic acid
TypeSmall organic molecule
Emp. Form.C27H25ClO6
Mol. Mass.480.937
SMILESOC(=O)COc1ccccc1C(=O)\C=C\c1ccc(OCCCCOc2ccc(Cl)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a