Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-tyrosine phosphatase alpha
LigandBDBM50326566
Substrate/Competitorn/a
Meas. Tech.ChEMBL_661806
pH7±n/a
IC50 88000±n/a nM
Commentsextracted
Citation Homan, KTBalasubramaniam, DZabell, APWiest, OHelquist, PStauffacher, CV Identification of novel inhibitors for a low molecular weight protein tyrosine phosphatase via virtual screening. Bioorg Med Chem18:5449-56 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-tyrosine phosphatase alpha
Name:Receptor-type tyrosine-protein phosphatase alpha
Synonyms:Receptor-type tyrosine-protein phosphatase alpha
Type:Enzyme
Mol. Mass.:90600.40
Organism:Homo sapiens (Human)
Description:P18433
Residue:802
Sequence:
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLS
VAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEP
WEGNSSTAATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNS
KQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKL
FREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINASF
INGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCW
TYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGM
LKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQ
RCQMVQTDMQYVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKL
TSIKIQNDKMRTGNLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQK
DSYIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITV
ELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQ
QQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQ
YEFCYKVVQEYIDAFSDYANFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50326566
NameBDBM50326566
Synonyms:2-hydroxy-3-(pyridin-2-yl)propanoic acid | CHEMBL1253274
TypeSmall organic molecule
Emp. Form.C8H9NO3
Mol. Mass.167.162
SMILESOC(Cc1ccccn1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a