Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSecreted effector protein
LigandBDBM26193
Substrate/Competitorn/a
Meas. Tech.ChEMBL_810616
Ki 1000000±n/a nM
Citation He, YZeng, LFYu, ZHHe, RLiu, SZhang, ZY Bicyclic benzofuran and indole-based salicylic acids as protein tyrosine phosphatase inhibitors. Bioorg Med Chem20:1940-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Secreted effector protein
Name:Secreted effector protein
Synonyms:Secreted protein-tyrosine phosphatase
Type:PROTEIN
Mol. Mass.:50881.86
Organism:Yersinia pestis
Description:ChEMBL_810616
Residue:468
Sequence:
MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARESEKVFAQTVL
SHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVSLRSDQMTLQDAKVLLEAA
LRQESGARGHVSSHSHSALHAPGTPVREGLRSHLDPRTPPLPPRERPHTSGHHGAGEARA
TAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACGGEKLNRFRDIQCCRQTAV
RADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPVLAVLASSSEIANQRFGMPD
YFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAGQKTISVPVVHVGNWPDQTAV
SSEVTKALASLVDQTAETKRNMYESKGSSAVGDDSKLRPVIHCRAGVGRTAQLIGAMCMN
DSRNSQLSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLAEGQGRPLLNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26193
NameBDBM26193
Synonyms:2-Hydroxybenzoate, I | 2-hydroxybenzoic acid | CHEMBL424 | phenol derivative, 7 | salicylic acid
TypeSmall organic molecule
Emp. Form.C7H6O3
Mol. Mass.138.1207
SMILESOC(=O)c1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a