Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase AKT
LigandBDBM50379530
Substrate/Competitorn/a
Meas. Tech.ChEMBL_811120
IC50 3021±n/a nM
Citation Bussenius, JAnand, NKBlazey, CMBowles, OJBannen, LCChan, DSChen, BCo, EWCostanzo, SDeFina, SCDubenko, LEngst, SFranzini, MHuang, PJammalamadaka, VKhoury, RGKim, MHKlein, RRLaird, DLe, DTMac, MBMatthews, DJMarkby, DMiller, NNuss, JMParks, JJTsang, THTsuhako, ALWang, YXu, WRice, KD Design and evaluation of a series of pyrazolopyrimidines as p70S6K inhibitors. Bioorg Med Chem Lett22:2283-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase AKT
Name:Serine/threonine-protein kinase AKT
Synonyms:AKT2 | PKB beta | Protein kinase Akt-2 | Protein kinase B (Akt 2) | Protein kinase B beta (AKT2) | Protein kinase B, beta | RAC-PK-beta | RAC-alpha serine/threonine-protein kinase (AKT2) | RAC-beta serine/threonine-protein kinase | RAC-beta serine/threonine-protein kinase (AKT2) | Serine/threonine-protein kinase AKT2
Type:Enzyme
Mol. Mass.:55766.64
Organism:Homo sapiens (human)
Description:n/a
Residue:481
Sequence:
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50379530
NameBDBM50379530
Synonyms:CHEMBL2012701
TypeSmall organic molecule
Emp. Form.C22H31ClN8
Mol. Mass.442.988
SMILESCCc1[nH]nc2ncnc(N3CCN(CC3)c3cc(Cl)cc(NCCN(C)C)c3C)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a