Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase AKT
LigandBDBM50379531
Substrate/Competitorn/a
Meas. Tech.ChEMBL_811120
IC50 311±n/a nM
Citation Bussenius, JAnand, NKBlazey, CMBowles, OJBannen, LCChan, DSChen, BCo, EWCostanzo, SDeFina, SCDubenko, LEngst, SFranzini, MHuang, PJammalamadaka, VKhoury, RGKim, MHKlein, RRLaird, DLe, DTMac, MBMatthews, DJMarkby, DMiller, NNuss, JMParks, JJTsang, THTsuhako, ALWang, YXu, WRice, KD Design and evaluation of a series of pyrazolopyrimidines as p70S6K inhibitors. Bioorg Med Chem Lett22:2283-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase AKT
Name:Serine/threonine-protein kinase AKT
Synonyms:AKT2 | PKB beta | Protein kinase Akt-2 | Protein kinase B (Akt 2) | Protein kinase B beta (AKT2) | Protein kinase B, beta | RAC-PK-beta | RAC-alpha serine/threonine-protein kinase (AKT2) | RAC-beta serine/threonine-protein kinase | RAC-beta serine/threonine-protein kinase (AKT2) | Serine/threonine-protein kinase AKT2
Type:Enzyme
Mol. Mass.:55766.64
Organism:Homo sapiens (human)
Description:n/a
Residue:481
Sequence:
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50379531
NameBDBM50379531
Synonyms:CHEMBL2012702
TypeSmall organic molecule
Emp. Form.C20H26BrClN8
Mol. Mass.493.831
SMILESCN(C)CCNc1cc(Cl)cc(N2CCN(CC2)c2ncnc3n[nH]c(Br)c23)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a