Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAxin-2
LigandBDBM50380592
Substrate/Competitorn/a
Meas. Tech.ChEMBL_813160
EC50 566±n/a nM
Citation Shultz, MDKirby, CAStams, TChin, DNBlank, JCharlat, OCheng, HCheung, ACong, FFeng, YFortin, PDHood, TTyagi, VXu, MZhang, BShao, W [1,2,4]triazol-3-ylsulfanylmethyl)-3-phenyl-[1,2,4]oxadiazoles: antagonists of the Wnt pathway that inhibit tankyrases 1 and 2 via novel adenosine pocket binding. J Med Chem55:1127-36 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Axin-2
Name:Axin-2
Synonyms:AXIN2 | Axil | Axin-like protein | Axis inhibition protein 2 | Conductin
Type:PROTEIN
Mol. Mass.:93575.69
Organism:Homo sapiens
Description:ChEMBL_813160
Residue:843
Sequence:
MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMSVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSL
LPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVH
CFCPGGSEYYCYSKCKSHSKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAP
GGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRH
HLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE
RID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380592
NameBDBM50380592
Synonyms:CHEMBL1552719
TypeSmall organic molecule
Emp. Form.C24H20N6O2S
Mol. Mass.456.52
SMILESCOc1ccc(cc1)-n1c(SCc2nc(no2)-c2ccc(C)cc2)nnc1-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM50380592
Synonyms:CHEMBL1552719
TypeSmall organic molecule
Emp. Form.C24H20N6O2S
Mol. Mass.456.52
SMILESCOc1ccc(cc1)-n1c(SCc2nc(no2)-c2ccc(C)cc2)nnc1-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: