Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B/Inner centromere protein
LigandBDBM50381716
Substrate/Competitorn/a
Meas. Tech.ChEMBL_816379
IC50 7±n/a nM
Citation Curtin, MLFrey, RRHeyman, HRSoni, NBMarcotte, PAPease, LJGlaser, KBMagoc, TJTapang, PAlbert, DHOsterling, DJOlson, AMBouska, JJGuan, ZPreusser, LCPolakowski, JSStewart, KDTse, CDavidsen, SKMichaelides, MR Thienopyridine ureas as dual inhibitors of the VEGF and Aurora kinase families. Bioorg Med Chem Lett22:3208-12 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B/Inner centromere protein
Name:Aurora kinase A/B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50381716
n/a
NameBDBM50381716
Synonyms:ABT-348 | ILORASERTIB | US8722890, 1 | US8722890, 2
TypeSmall organic molecule
Emp. Form.C25H21FN6O2S
Mol. Mass.488.537
SMILESNc1ncc(-c2cnn(CCO)c2)c2scc(-c3ccc(NC(=O)Nc4cccc(F)c4)cc3)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: