Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty acid-binding protein, adipocyte
LigandBDBM50212873
Substrate/Competitorn/a
Meas. Tech.ChEMBL_817178
Ki 29±n/a nM
Citation Xu, QHuang, LLiu, JMa, LChen, TChen, JPeng, FCao, DYang, ZQiu, NQiu, JWang, GLiang, XPeng, AXiang, MWei, YChen, L Design, synthesis and biological evaluation of thiazole- and indole-based derivatives for the treatment of type II diabetes. Eur J Med Chem52:70-81 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fatty acid-binding protein, adipocyte
Name:Fatty acid-binding protein, adipocyte
Synonyms:A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | Adipocyte-type fatty acid-binding protein | Fabp4 | Fatty acid-binding protein 4
Type:PROTEIN
Mol. Mass.:14709.32
Organism:Rattus norvegicus
Description:ChEMBL_817178
Residue:132
Sequence:
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNLIISVEGDLVVIRSESTFKN
TEISFKLGVEFDEITPDDRKVKSIITLDGGVLVHVQKWDGKSTTIKKRRDGDKLVVECVM
KGVTSTRVYERA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50212873
n/a
NameBDBM50212873
Synonyms:((2'-(5-ETHYL-3,4-DIPHENYL-1H-PYRAZOL-1-YL)-3-BIPHENYLYL)OXY)ACETIC ACID | BMS309403 | CHEMBL247920 | [2'-(5-Ethyl-3,4-diphenyl-pyrazol-1-yl)-biphenyl-3-yloxy]-acetic acid
TypeSmall organic molecule
Emp. Form.C31H26N2O3
Mol. Mass.474.5497
SMILESCCc1c(c(nn1-c1ccccc1-c1cccc(OCC(O)=O)c1)-c1ccccc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: