Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B
LigandBDBM50382010
Substrate/Competitorn/a
Meas. Tech.ChEMBL_815111
EC50 389±n/a nM
Citation Voss, MERainka, MPFleming, MPeterson, LHBelanger, DBSiddiqui, MAHruza, AVoigt, JGray, KBasso, AD Synthesis and SAR studies of imidazo-[1,2-a]-pyrazine Aurora kinase inhibitors with improved off-target kinase selectivity. Bioorg Med Chem Lett22:3544-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B
Name:Aurora kinase B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50382010
NameBDBM50382010
Synonyms:CHEMBL2023297
TypeSmall organic molecule
Emp. Form.C28H29F2N9OS
Mol. Mass.577.651
SMILESCc1cn2c(cnc2c(Nc2cc(CN3CCCCC3)ns2)n1)-c1cnn(CC(=O)NCc2cc(F)cc(F)c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a