Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman diphtheria toxin-like ADP-ribosyltransferase (ARTD6 or PARP5b)
LigandBDBM50318567
Substrate/Competitorn/a
Meas. Tech.ChEMBL_818395
IC50 4±n/a nM
Citation Narwal, MVenkannagari, HLehtiö, L Structural basis of selective inhibition of human tankyrases. J Med Chem55:1360-7 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human diphtheria toxin-like ADP-ribosyltransferase (ARTD6 or PARP5b)
Name:Tankyrase 1/2
Synonyms:(ARTD6 or PARP5b) | Tankyrase 1/2 | Tankyrase-1 (TNKS1) | Tankyrase-2 | Tankyrase-2 (TNKS-2) | Tankyrase-2 (TNKS2)
Type:Enzyme
Mol. Mass.:126937.16
Organism:Homo sapiens (Human)
Description:Q9H2K2
Residue:1166
Sequence:
MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKST
PLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNAR
DNWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDE
LLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAK
DKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYG
ADPTLLNCHNKSAIDLAPTPQLKERLAYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKH
PQTHETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVV
KHEAKVNALDNLGQTSLHRAAYCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQL
LQEGISLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVS
VVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAA
AKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLAR
VKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAA
SYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQT
PLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATADALSSGPSSPSSLSAASS
LDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEHLMDIFEREQIT
LDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSP
DDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEEN
HNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTG
CPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYV
IYRGEQAYPEYLITYQIMRPEGMVDG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50318567
NameBDBM50318567
Synonyms:2-(4-(Trifluoromethyl)phenyl)-7,8-dihydro-5H-thiopyrano-[4,3-d]pyrimidin-4-ol | 2-[4-(trifluoromethyl)phenyl]-7,8-dihydro-5H-thiopyrano[4,3-d]pyrimidin-4-ol | CHEMBL1086580
TypeSmall organic molecule
Emp. Form.C14H11F3N2OS
Mol. Mass.312.31
SMILESFC(F)(F)c1ccc(cc1)-c1nc2CCSCc2c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a