Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase alpha 5
LigandBDBM24466
Substrate/Competitorn/a
Meas. Tech.ChEMBL_819213
IC50 100000±n/a nM
Citation Liu, LNorman, MHLee, MXi, NSiegmund, ABoezio, AABooker, SChoquette, DD'Angelo, NDGermain, JYang, KYang, YZhang, YBellon, SFWhittington, DAHarmange, JCDominguez, CKim, TSDussault, I Structure-based design of novel class II c-Met inhibitors: 2. SAR and kinase selectivity profiles of the pyrazolone series. J Med Chem55:1868-97 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosomal protein S6 kinase alpha 5
Name:Ribosomal protein S6 kinase
Synonyms:90 kDa ribosomal protein S6 kinase 5 | Mitogen- and Stress-Activated Protein Kinase 1 (MSK1) | Nuclear mitogen- and stress-activated protein kinase 1 | Nuclear mitogen- and stress-activated protein kinase 1 (MSK1) | RPS6KA5(Kin.Dom.2 - C-terminal) | RSK-like protein kinase | RSKL | Ribosomal protein S6 kinase alpha-5
Type:Serine/threonine-protein kinase
Mol. Mass.:89874.44
Organism:Homo sapiens (Human)
Description:n/a
Residue:802
Sequence:
MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAY
GKVFLVRKISGHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYA
FQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKL
ENILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWS
LGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSALAKDLIQRLLMKDPKK
RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYS
PAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY
QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPN
IVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGV
VHRDLKPENLLFTDENDNLEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYD
ESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEA
KDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFH
AFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTL
QPSNPADSNNPETLFQFSDSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM24466
NameBDBM24466
Synonyms:1-(2-hydroxy-2-methylpropyl)-N-{5-[(7-methoxyquinolin-4-yl)oxy]pyridin-2-yl}-5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazole-4-carboxamide | Substituted Pyrazolone, 17
TypeSmall organic molecule
Emp. Form.C30H29N5O5
Mol. Mass.539.5818
SMILESCOc1ccc2c(Oc3ccc(NC(=O)c4c(C)n(CC(C)(C)O)n(-c5ccccc5)c4=O)nc3)ccnc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a