BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTau
LigandBDBM50384538
Substrate/Competitorn/a
Meas. Tech.ChEMBL_820514
Ki 13±n/a nM
Citation  n/a ACS Med Chem Lett3:58-62 (2012)    Article
More Info.:Get all data from this article,  Assay Method
 
Tau
Name:Tau
Synonyms:MAPT | MAPTL | MTBT1 | Microtubule-associated protein tau | Neurofibrillary tangle protein | PHF-tau | Paired helical filament-tau | Tau Protein
Type:Protein
Mol. Mass.:78928.63
Organism:Homo sapiens (Human)
Description:P10636
Residue:758
Sequence:
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEG
GRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA
QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPA
AAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK
GQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREP
KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD
LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEK
LDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT
SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50384538
n/a
NameBDBM50384538
Synonyms:CHEMBL2036419 | CHEMBL2036420
TypeSmall organic molecule
Emp. Form.C21H25FN4O3S
Mol. Mass.432.512
SMILESCN(C)c1ccc(cc1)\N=N\c1nc2ccc(OCCOCCOCCF)cc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: