Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin D Synthase
LigandBDBM50385148
Substrate/Competitorn/a
Meas. Tech.ChEMBL_823085
IC50 6900±n/a nM
Citation Trujillo, JIKiefer, JRHuang, WDay, JEMoon, JJerome, GMBono, CPKornmeier, CMWilliams, MLKuhn, CRennie, GRWynn, TACarron, CPThorarensen, A Investigation of the binding pocket of human hematopoietic prostaglandin (PG) D2 synthase (hH-PGDS): a tale of two waters. Bioorg Med Chem Lett22:3795-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin D Synthase
Name:Prostaglandin D Synthase
Synonyms:Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | Prostaglandin D
Type:Enzyme
Mol. Mass.:23341.07
Organism:Homo sapiens (Human)
Description:The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag.
Residue:199
Sequence:
MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50385148
NameBDBM50385148
Synonyms:CHEMBL2035648
TypeSmall organic molecule
Emp. Form.C16H19N3O2
Mol. Mass.285.341
SMILESCOc1ccccc1N1CCN(CC1)C(=O)c1ccc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a