Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3)
LigandBDBM35901
Substrate/Competitorn/a
Meas. Tech.ChEMBL_823517
IC50 160±n/a nM
Citation Adeniji, AOTwenter, BMByrns, MCJin, YChen, MWinkler, JDPenning, TM Development of potent and selective inhibitors of aldo-keto reductase 1C3 (type 5 17ß-hydroxysteroid dehydrogenase) based on N-phenyl-aminobenzoates and their structure-activity relationships. J Med Chem55:2311-23 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3)
Name:Aldo-keto-reductase family 1 member C3
Synonyms:3-alpha-HSD type 2 | Aldo-keto reductase family 1 member C3 | Aldo-keto reductase family 1 member C3 (AK1C3) | Aldo-keto reductase family 1 member C3 (AK1C3a) | Aldo-keto reductase family 1 member C3 (AKR1C3) | Dihydrodiol dehydrogenase 3 | Dihydrodiol dehydrogenase type I | Estradiol 17-beta-dehydrogenase | Prostaglandin F synthase | Testosterone 17-beta-dehydrogenase 5 | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
Type:Enzyme
Mol. Mass.:36859.86
Organism:Homo sapiens (human)
Description:P42330
Residue:323
Sequence:
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35901
NameBDBM35901
Synonyms:cid_201986 | flufenamic acid analogue, 28
TypeSmall organic molecule
Emp. Form.C13H10N2O4
Mol. Mass.258.2295
SMILESOC(=O)c1ccccc1Nc1ccc(cc1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a