BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine aminotransferase II (KAT II)
LigandBDBM50386310
Substrate/Competitorn/a
Meas. Tech.ChEMBL_826598
IC50 22±n/a nM
Citation  n/a ACS Med Chem Lett3:187-192 (2012)    Article
More Info.:Get all data from this article,  Assay Method
 
Kynurenine aminotransferase II (KAT II)
Name:Kynurenine aminotransferase II (KAT II)
Synonyms:2-aminoadipate aminotransferase | 2-aminoadipate transaminase | AADAT | Alpha-aminoadipate aminotransferase | KAT/AadAT | KAT2 | Kynurenine aminotransferase II | Kynurenine--oxoglutarate aminotransferase II | Kynurenine--oxoglutarate transaminase 2 | Kynurenine--oxoglutarate transaminase II | Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
Type:Enzyme
Mol. Mass.:47353.09
Organism:Homo sapiens (Human)
Description:Q8N5Z0
Residue:425
Sequence:
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV
KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50386310
n/a
NameBDBM50386310
Synonyms:CHEMBL2049092
TypeSmall organic molecule
Emp. Form.C10H12N2O3
Mol. Mass.208.2139
SMILESCOc1ccc2C[C@H](N)C(=O)N(O)c2c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: