Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFree fatty acid receptor 1
LigandBDBM50386650
Substrate/Competitorn/a
Meas. Tech.ChEMBL_826836
Ki 4.5±n/a nM
Citation Mikami, SKitamura, SNegoro, NSasaki, SSuzuki, MTsujihata, YMiyazaki, TIto, RSuzuki, NMiyazaki, JSantou, TKanzaki, NFunami, MTanaka, TYasuma, TMomose, Y Discovery of phenylpropanoic acid derivatives containing polar functionalities as potent and orally bioavailable G protein-coupled receptor 40 agonists for the treatment of type 2 diabetes. J Med Chem55:3756-76 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Free fatty acid receptor 1
Name:Free fatty acid receptor 1
Synonyms:G-protein coupled receptor 40
Type:PROTEIN
Mol. Mass.:31848.38
Organism:Rattus norvegicus
Description:ChEMBL_1511162
Residue:300
Sequence:
MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLACSDLLLAITLP
LKAVEALASGVWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
CYSWGVCVAIWALVLCHLGLALGLEAPRGWVDNTTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVHSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLEGSWRKLGLITGAWSVVLNPLVTGYLGTGPGQGTICVTRTPRGTIQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50386650
NameBDBM50386650
Synonyms:CHEMBL2048627
TypeSmall organic molecule
Emp. Form.C30H34FNO6S
Mol. Mass.555.657
SMILESCc1cc(OCC2(O)CCS(=O)(=O)CC2)cc(C)c1-c1cccc(CNc2ccc(CCC(O)=O)c(F)c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a