Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 119 (GPR119)
LigandBDBM50387895
Substrate/Competitorn/a
Meas. Tech.ChEMBL_830702
EC50 254±n/a nM
Citation Sakairi, MKogami, MTorii, MKataoka, HFujieda, HMakino, MKataoka, DOkamoto, RMiyazawa, TOkabe, MInoue, MTakahashi, NHarada, SWatanabe, N Synthesis and SAR studies of bicyclic amine series GPR119 agonists. Bioorg Med Chem Lett22:5123-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G-protein coupled receptor 119 (GPR119)
Name:Glucose-dependent insulinotropic receptor
Synonyms:Glucose-dependent insulinotropic receptor
Type:Protein
Mol. Mass.:36901.49
Organism:Homo sapiens (Human)
Description:Q8TDV5
Residue:335
Sequence:
MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISG
LLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGF
VAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLL
FVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTP
FLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKV
LTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50387895
NameBDBM50387895
Synonyms:CHEMBL2058395
TypeSmall organic molecule
Emp. Form.C20H30N2O5S
Mol. Mass.410.528
SMILESCC(C)(C)OC(=O)N1CCC(CCCNc2ccc3c(OCS3(=O)=O)c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a