Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B
LigandBDBM50389254
Substrate/Competitorn/a
Meas. Tech.ChEMBL_831558
IC50 140±n/a nM
Citation Ji, ZDai, YAbad-Zapatero, CAlbert, DHBouska, JJGlaser, KBMarcotte, PASoni, NBMagoc, TJStewart, KDWei, RQDavidsen, SKMichaelides, MR Exploration of diverse hinge-binding scaffolds for selective Aurora kinase inhibitors. Bioorg Med Chem Lett22:4528-31 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B
Name:Aurora kinase B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50389254
NameBDBM50389254
Synonyms:CHEMBL2063440
TypeSmall organic molecule
Emp. Form.C21H16ClN5O3
Mol. Mass.421.836
SMILESNc1noc2cccc(C(=O)Nc3ccc(NC(=O)Nc4ccc(Cl)cc4)cc3)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a