Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTau
LigandBDBM50390104
Substrate/Competitorn/a
Meas. Tech.ChEMBL_834363
Ki 599±n/a nM
Citation Watanabe, HOno, MKimura, HMatsumura, KYoshimura, MOkamoto, YIhara, MTakahashi, RSaji, H Synthesis and biological evaluation of novel oxindole derivatives for imaging neurofibrillary tangles in Alzheimer's disease. Bioorg Med Chem Lett22:5700-3 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tau
Name:Tau
Synonyms:MAPT | MAPTL | MTBT1 | Microtubule-associated protein tau | Neurofibrillary tangle protein | PHF-tau | Paired helical filament-tau | Tau Protein
Type:Protein
Mol. Mass.:78928.63
Organism:Homo sapiens (Human)
Description:P10636
Residue:758
Sequence:
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEG
GRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA
QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPA
AAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK
GQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREP
KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD
LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEK
LDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT
SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50390104
n/a
NameBDBM50390104
Synonyms:CHEMBL2069431
TypeSmall organic molecule
Emp. Form.C17H15IN2O
Mol. Mass.390.2183
SMILESCN(C)c1ccc(C=C2C(=O)Nc3ccc(I)cc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: