Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAsparagine synthetase
LigandBDBM50392270
Substrate/Competitorn/a
Meas. Tech.ChEMBL_851317
Ki 490±n/a nM
Citation Ikeuchi, HAhn, YMOtokawa, TWatanabe, BHegazy, LHiratake, JRichards, NG A sulfoximine-based inhibitor of human asparagine synthetase kills L-asparaginase-resistant leukemia cells. Bioorg Med Chem20:5915-27 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Asparagine synthetase
Name:Asparagine synthetase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:64373.20
Organism:Homo sapiens (Human)
Description:ChEMBL_851327
Residue:561
Sequence:
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGV
FAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFN
NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
WFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPK
WINATDPSARTLTHYKSAVKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50392270
NameBDBM50392270
Synonyms:CHEMBL2153507
TypeSmall organic molecule
Emp. Form.C13H22N7O7PS
Mol. Mass.451.395
SMILESCS(=O)(NP([O-])(=O)OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12)=CC[NH3+] |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a