Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-secretase 1
LigandBDBM50392774
Substrate/Competitorn/a
Meas. Tech.ChEMBL_853104
IC50 110±n/a nM
Citation Kaller, MRHarried, SSAlbrecht, BAmarante, PBabu-Khan, SBartberger, MDBrown, JBrown, RChen, KCheng, YCitron, MCroghan, MDGraceffa, RHickman, DJudd, TKriemen, CLa, DLi, VLopez, PLuo, YMasse, CMonenschein, HNguyen, TPennington, LDMiguel, TSSickmier, EAWahl, RCWeiss, MMWen, PHWilliamson, TWood, SXue, MYang, BZhang, JPatel, VZhong, WHitchcock, S A Potent and Orally Efficacious, Hydroxyethylamine-Based Inhibitor of -Secretase. ACS Med Chem Lett3:886-891 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-secretase 1
Name:Beta-secretase 1
Synonyms:ASP2 | Asp 2 | Aspartyl protease 2 | BACE | BACE1 | Beta-secretase 1 (BACE 1) | Beta-secretase 1 (BACE-1) | Beta-secretase 1 (BACE1) | Beta-site APP cleaving enzyme 1 | Beta-site amyloid precursor protein cleaving enzyme 1 | KIAA1149 | Memapsin-2 | Membrane-associated aspartic protease 2 | beta-Secretase (BACE-1) | beta-Secretase (BACE1)
Type:Protein
Mol. Mass.:55701.04
Organism:Homo sapiens (Human)
Description:P56817
Residue:501
Sequence:
MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSF
VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSST
YRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGIL
GLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGI
DHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
VFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRIT
ILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC
HVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQW
RCLRCLRQQHDDFADDISLLK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50392774
NameBDBM50392774
Synonyms:CHEMBL2151149
TypeSmall organic molecule
Emp. Form.C26H34N2O3
Mol. Mass.422.5598
SMILESCCc1ccc2OC3(CCC3)C[C@H](NC[C@@H](O)[C@H](Cc3ccccc3)NC(C)=O)c2c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a