Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetStearoyl-CoA desaturase 1 (SCD1)
LigandBDBM50362592
Substrate/Competitorn/a
Meas. Tech.ChEMBL_852941
IC50 3±n/a nM
Citation Oballa, RMBelair, LBlack, WCBleasby, KChan, CCDesroches, CDu, XGordon, RGuay, JGuiral, SHafey, MJHamelin, EHuang, ZKennedy, BLachance, NLandry, FLi, CSMancini, JNormandin, DPocai, APowell, DARamtohul, YKSkorey, KSørensen, DSturkenboom, WStyhler, AWaddleton, DMWang, HWong, SXu, LZhang, L Development of a liver-targeted stearoyl-CoA desaturase (SCD) inhibitor (MK-8245) to establish a therapeutic window for the treatment of diabetes and dyslipidemia. J Med Chem54:5082-96 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Stearoyl-CoA desaturase 1 (SCD1)
Name:Stearoyl-CoA desaturase 1 (SCD1)
Synonyms:Acyl-CoA desaturase 1
Type:Enzyme
Mol. Mass.:41485.97
Organism:Rattus norvegicus (Rat)
Description:P07308
Residue:358
Sequence:
MPAHMLQEISSSYTTTTTITEPPSGNLQNGREKMKKVPLYLEEDIRPEMREDIHDPSYQD
EEGPPPKLEYVWRNIILMALLHVGALYGITLIPSSKVYTLLWGIFYYLISALGITAGAHR
LWSHRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSH
VGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGET
FLHSLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYH
HAFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAVLARIKRTGDGSHKSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50362592
n/a
NameBDBM50362592
Synonyms:CHEMBL1938870
TypeSmall organic molecule
Emp. Form.C17H16BrFN6O4
Mol. Mass.467.249
SMILESOC(=O)Cn1nnc(n1)-c1cc(no1)N1CCC(CC1)Oc1cc(F)ccc1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: