Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4A
LigandBDBM50042058
Substrate/Competitorn/a
Meas. Tech.ChEMBL_856427
EC50 480±n/a nM
Citation Day, JPLindsay, BRiddell, TJiang, ZAllcock, RWAbraham, ASookup, SChristian, FBogum, JMartin, EKRae, RLAnthony, DRosair, GMHouslay, DMHuston, EBaillie, GSKlussmann, EHouslay, MDAdams, DR Elucidation of a structural basis for the inhibitor-driven, p62 (SQSTM1)-dependent intracellular redistribution of cAMP phosphodiesterase-4A4 (PDE4A4). J Med Chem54:3331-47 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4A
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4A
Synonyms:PDE46 | PDE4A | Phosphodiesterase 4A (PDE4) | cAMP-specific 3 ,5 -cyclic phosphodiesterase 4A | cAMP-specific 3,5-cyclic phosphodiesterase 4A
Type:Enzyme
Mol. Mass.:98113.27
Organism:Homo sapiens (human)
Description:P27815
Residue:886
Sequence:
MEPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERAERERQ
PHRPIERADAMDTSDRPGLRTTRMSWPSSFHGTGTGSGGAGGGSSRRFEAENGPTPSPGR
SPLDSQASPGLVLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTP
FAQVLASLRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEELDW
CLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEI
PSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTD
QEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYML
TLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGV
SNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDM
VLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLE
LYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADL
VHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEE
ISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASLEAELEAVYLT
QQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLP
STAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042058
NameBDBM50042058
Synonyms:(-)-rolipram | (4R)-4-[3-(cyclopentyloxy)-4-methoxyphenyl]pyrrolidin-2-one | (R)-(-)-rolipram | (R)-rolipram | CHEMBL430893
TypeSmall organic molecule
Emp. Form.C16H21NO3
Mol. Mass.275.3428
SMILESCOc1ccc(cc1OC1CCCC1)[C@@H]1CNC(=O)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a