Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA A receptor alpha-1/beta-1/gamma-2
LigandBDBM50055935
Substrate/Competitorn/a
Meas. Tech.ChEMBL_859592
IC50 1000000±n/a nM
Citation Savechenkov, PYZhang, XChiara, DCStewart, DSGe, RZhou, XRaines, DECohen, JBForman, SAMiller, KWBruzik, KS Allyl m-trifluoromethyldiazirine mephobarbital: an unusually potent enantioselective and photoreactive barbiturate general anesthetic. J Med Chem55:6554-65 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GABA A receptor alpha-1/beta-1/gamma-2
Name:GABA A receptor alpha-1/beta-1/gamma-2
Synonyms:GABA A Alpha1Beta1Gamma2 | GABA A Alpha1Beta2Gamma2 | GABA A Alpha1Beta3Gamma2 | GABA A Benzodiazepine brain | GABA A Benzodiazepine liver | GABA receptor alpha-1 subunit | GABA(A) receptor subunit alpha-1 | GABA-A | GABA-A receptor | Gamma-aminobutyric acid receptor subunit alpha (GABAA) | Gamma-aminobutyric acid receptor subunit alpha-1 | TBPS | agonist GABA site
Type:Protein
Mol. Mass.:51817.35
Organism:Homo sapiens (Human)
Description:P14867
Residue:456
Sequence:
MRKSPGLSDCLWAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPG
LGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHAC
PLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVM
TTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP
LIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID
RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50055935
NameBDBM50055935
Synonyms:5-Ethyl-5-(1-methylbutyl)-2,4,6(1H,3H,5H)-pyrimidinetrione | 5-ethyl-5-(1-methylbutyl)barbituric acid | 5-ethyl-5-(pentan-2-yl)pyrimidine-2,4,6(1H,3H,5H)-trione | 5-ethyl-5-(sec-pentyl)barbituric acid | CHEMBL448 | Nembutal | PENTOBARBITAL | Pentobarbitone
TypeSmall organic molecule
Emp. Form.C11H18N2O3
Mol. Mass.226.2722
SMILESCCCC(C)C1(CC)C(=O)NC(=O)NC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a